PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_01029A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 232aa    MW: 25560.3 Da    PI: 10.1313
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_01029AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.6e-171461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd +l+     +G+g+W+t++++ g++R++k+c++r+ +yl
  Oropetium_20150105_01029A 14 KGPWTPEEDAKLLAFTSTHGTGNWTTVPQRAGLKRCGKSCRLRYTNYL 61
                               79********************************************97 PP

2Myb_DNA-binding54.13.5e-1769110346
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                ++T+eE+el+v ++++lG++ W++Ia+ ++ gRt++++k++w++
  Oropetium_20150105_01029A  69 NFTQEEEELIVTLHAMLGSR-WSLIANQLP-GRTDNDVKNYWNT 110
                                89******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.0E-24565IPR009057Homeodomain-like
PROSITE profilePS5129416.868961IPR017930Myb domain
SuperFamilySSF466891.91E-3011108IPR009057Homeodomain-like
SMARTSM007175.0E-141363IPR001005SANT/Myb domain
PfamPF002491.5E-151461IPR001005SANT/Myb domain
CDDcd001671.46E-111661No hitNo description
PROSITE profilePS5129425.00362116IPR017930Myb domain
SMARTSM007173.5E-1566114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-2466116IPR009057Homeodomain-like
PfamPF002492.2E-1569110IPR001005SANT/Myb domain
CDDcd001674.03E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MGRPPCCDKA NVKKGPWTPE EDAKLLAFTS THGTGNWTTV PQRAGLKRCG KSCRLRYTNY  60
LRPNLKHENF TQEEEELIVT LHAMLGSRWS LIANQLPGRT DNDVKNYWNT KLSKKLRQRG  120
IDPITHRPIA DLMHSIGALA IRPPPQHPNT SAYLPAAPPP LVRDVAAYHA AAAVQQQQQV  180
LIDAGDAPAS PDQLQQLKLA RVAKQLTHHQ IINAVKSIPG PHQSILLESN G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0854910.0BT085491.1 Zea mays full-length cDNA clone ZM_BFc0020H06 mRNA, complete cds.
GenBankEU9670890.0EU967089.1 Zea mays clone 299414 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465411.11e-113hypothetical protein SORBIDRAFT_01g038250
SwissprotQ9XHV04e-67MYB80_ARATH; Transcription factor MYB80
TrEMBLC5WNH11e-113C5WNH1_SORBI; Putative uncharacterized protein Sb01g038250
STRINGSb01g038250.11e-113(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118743439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.17e-68myb domain protein 103